PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 958aa    MW: 107729 Da    PI: 5.1051
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1800genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.6e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      Gh_D13G1800  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
      Gh_D13G1800  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001674.79E-121053No hitNo description
PfamPF139214.1E-131070No hitNo description
SuperFamilySSF466898.27E-2133106IPR009057Homeodomain-like
CDDcd116591.08E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.3E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118311.2E-60406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 958 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACARD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKRPP PGFYDVADED RPVEQPKFPT  240
TIEELEGKRR VDIEAQLRKQ DIAKNKISQR QDTPSAILQA NKLNDPETVR KRSKLMLPSP  300
QISDHELEEI AKMGYASDLL AENEELAGGS GATRALLANY SQTPRPGMTP LRTPQRTPAG  360
KGDAIMMEAE NLARLRESQT PLLGGENPEL HPSDFSGVTP KTQILTPNPM LTPAATPGTA  420
GLTPRTGMTP SRDVYSFALT PKGTPIRDGL HINEEMDLHD SAKLEQRRQA DLRRNLRSGL  480
GTLPQPKNEY QIVIQPPPED NEEPEEKIEE DMSDRIARER AEEEARQQAL LKKRSKVLQR  540
ELPRPPSASL ELIRDSLMRT DGDKSSFVPP TSIEQADEMI RKELLSLLEH DNAKYPLDEK  600
ANKAKKKGAK RPANGSIPSI EDFEEEEMKE ADSLIKEEAE FLRVAMGHEN ESLDDFVEAH  660
NTCLNDLMYF PTRNAYGLSS VAGNMEKLAA LQTEFENVKK KMDNDKSKAE SMEKKYNVLT  720
QGYERRAATL WRHIESTVKQ IDTAGTELEC FQALQKQEHL AASHRINGLW EEVQKQKELE  780
QTLQRRYGNL MSELERMQRL MNVYRAQAEK QEEAGEKNHA LELSEAAASQ VAVPSAGHSE  840
PAPSLEHLDS SLDGLPSAEV DVNADSGKEH ATMDIGTDGN MHINEALVVE DKGDDITQTL  900
NKMSGDAATS SEAATESINP DSVSTKQESI QETVEATEVD NSCVLGGDTA ENQTGMEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.221210.0boll| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461998.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0D2SGG70.0A0A0D2SGG7_G
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64532742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5